PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042044m
Common NameCISIN_1g042044mg, LOC102623916
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25565.3 Da    PI: 9.5884
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042044mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.7e-27959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien snrqvt+skRrng++KKA+E+ vLCda+v++iif+++gk+++yss
  orange1.1g042044m  9 KRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSS 59
                       79***********************************************96 PP

2K-box85.89e-2969165197
              K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                        y+k+sgk+l++ak+e+l++e++++kke++++q ++Rhl+Ged++sL++keL+ Le++Le++l+ iR+k++e++ ++ ++ ++ e+e++  + 
  orange1.1g042044m  69 YHKQSGKKLWDAKHENLYNEIDRIKKENDSMQIKLRHLKGEDVTSLNHKELMALEDALENGLTGIRDKQSEMMERMRKNGKMLEEEHNYLKY 160
                        899**********************************************************************9999999999999999888 PP

              K-box  93 aLrkk 97 
                         Lr++
  orange1.1g042044m 161 VLRQQ 165
                        88887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.7E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.048161IPR002100Transcription factor, MADS-box
CDDcd002652.65E-38278No hitNo description
SuperFamilySSF554558.11E-34294IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.2E-1980160IPR002487Transcription factor, K-box
PROSITE profilePS5129714.47882176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGRGKIEIKR IENLSNRQVT YSKRRNGLIK KAKEIAVLCD AKVSLIIFAT SGKMHDYSSA  60
PMFEILEAYH KQSGKKLWDA KHENLYNEID RIKKENDSMQ IKLRHLKGED VTSLNHKELM  120
ALEDALENGL TGIRDKQSEM MERMRKNGKM LEEEHNYLKY VLRQQEIAKQ QQQQMALENN  180
VREIDPNGYH QRENDGYSSH MPLAFRVQPI QPNLQERI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-17173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-17173173Myocyte-specific enhancer factor 2B
1tqe_R3e-17173173Myocyte-specific enhancer factor 2B
1tqe_S3e-17173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006472853.11e-161PREDICTED: floral homeotic protein GLOBOSA isoform X1
SwissprotQ034161e-100GLOB_TOBAC; Floral homeotic protein GLOBOSA
TrEMBLA0A067GP561e-161A0A067GP56_CITSI; Uncharacterized protein
STRINGVIT_18s0001g01760.t012e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-81MIKC_MADS family protein